PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DS_691A715BD.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 175aa    MW: 19716.3 Da    PI: 8.51
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DS_691A715BD.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.91.9e-07701122163
                            HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            RqRKk+++ e ++ v +L  eN++L +e+ el+  +++l +e+
  Traes_6DS_691A715BD.1  70 RQRKKMRLPEVQQLVRSLAVENESLHEEMRELQRACSALSKEN 112
                            9**************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.8E-470108No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
FGLVSVRDVL GRGSCCGLWF HPPSWSVIRC SLIGLVWLLT TAHYPSLQVG SIRRPQLTFQ  60
APPPRPAGQR QRKKMRLPEV QQLVRSLAVE NESLHEEMRE LQRACSALSK ENDKLETRIV  120
EQSNSRNEAT LKEQKGKQQQ LDQQQQQQQQ SPHDSFALPD LNLPAQDGAD GSVPC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16975RQRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3642101e-147AK364210.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2022L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233917.12e-52PREDICTED: uncharacterized protein LOC100835852
TrEMBLW5H3171e-126W5H317_WHEAT; Uncharacterized protein
STRINGMLOC_36367.12e-67(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]